The repository: karlicoss/HPI and blog post.
This is a sort of todo-list with raw ideas and things not (yet?) worthy of github issues.
[2020-01-17] Chatistics | Python scripts to parse your Messenger, Hangouts, WhatsApp and Telegram chat logs into DataFrames [2020-03-21] KrauseFx/FxLifeSheet: Tracking the key metrics of my life [[qs]][2019-12-11] Solid (web decentralization project) - Wikipedia [[solid]][2019-12-18] ErikBjare/chatalysis: Analyse (group)chat messages [2020-05-08] How this site works | Jack Reid [[hpi]][2020-05-18] Quarantine Notes - Week 10 | Ben Congdon [2021-02-28] Archivers [[hpi]][2021-03-19] LifeScope [[qs]] [[dashboard]] [[hpi]][2020-05-14] could caption "HPI meets X" [[toblog]][2021-02-04] Apache Arrow 3.0 | Hacker News [[hpi]][2020-03-18] ricklamers/gridstudio: Grid studio is a web-based application for data science with full integration of open source data science frameworks and languages [[pandas]][2020-05-09] Live demo · andrey-utkin/taskdb Wiki [2020-09-11] Kate on Twitter: "I made a super simple CLI plotting thingy, reads numbers on stdin, draws svg to stdout. Just for seeing the shape of data. It’s written in awk. https://t.co/TFYKbn2SKT" / Twitter [[tui]][2021-02-08] Bram Wiepjes / baserow · GitLab [[hpi]] [[exobrain]][2020-10-31] Welcome to pyspread | pyspread [[hpi]] [[python]] [[spreadsheets]][2020-01-10] Repl.it - Feed https://repl.it/talk/all?lang=python_turtle [[project]] [[promnesia]] [[demo]][2020-10-16] Need your insights on a “Self Data Hub” ideation - Quantified Self / Apps & Tools - Quantified Self Forum [2020-02-03] Foreign data wrappers - PostgreSQL wiki [[hpi]][2019-12-20] Datasette — Datasette documentation tool for exploring data? [2021-01-01] List Of Virtual Tables [[sqlite]][2020-12-14] Simon Willison (@simonw): "sqlite-utils 3.1 adds a new command: sqlite-utils analyze-tables my.db It queries every column of every table and outputs useful statistics about them: https://sqlite-utils.readthedocs.io/en/stable/changelog.html#v3-1" | nitter [[hpi]][2021-02-14] influxdata/influxdb-python: Python client for InfluxDB [[influx]] [[pandas]] [[hpi]][2020-06-16] A Jupyter Kernel for SQLite [[hpi]][2020-05-08] heedy/heedy: An Open-Source Platform for Quantified Self & IoT [[qs]][2021-02-11] Repl.it - Hosting Apps with Always On [[hpi]] [[promnesia]] [[computing]][2020-10-15] wger-project/wger: Self hosted FLOSS fitness/workout and weight tracker written with Django [[exercise]][2020-01-29] Typesense: Open-Source Alternative to Algolia [[hpi]] [[search]][2021-03-05] Simon Willison (@simonw) / Twitter [[hpi]]get_files](#dccrprmtvgtfls TIDDLYLINK) [2021-02-26] karlicoss (ex. jestem króliczkiem) on Twitter: "@nikitavoloboev I guess if I decide on some opinionated defaults it could just be a single container/VM (maybe you’d need to specify the path to data on disk and that’s it). After that maybe people can decide whether they are happy with the defaults or are willing to tweak." / Twitter [[hpi]] [[dashboard]] [[promnesia]][2020-11-10] User workflow documentation / understanding how components fit together · Issue 125 · karlicoss/promnesia [2020-05-18] HPI/SETUP.org at master · karlicoss/HPI [2020-05-08] intake.github.io/status https://intake.github.io/status [[inspiration]]make_config isn’t even necessary if you’re not using default attributes](#mntnthtsngmkcnfgsntvnncssryfyrntsngdfltttrbts TIDDLYLINK) make_config as far as possible, and just use properties directly instead?? it’s only necessary for truly complicated hackery](#vdmkcnfgsfrspssblndjstspryncssryfrtrlycmplctdhckry TIDDLYLINK) hpi install [--user] my.modulename [[hpi]][2019-12-24] inspiration: hugginn credentials inspiration: [2020-05-16] Lazy — MacroPy3 1.1.0 documentation [[python]][2020-05-03] reddit: zstd vs lz4 comparison [[reddit]] [[exports]] [[hpi]][2020-05-03] comparison of zstd vs lz4 [[reddit]] [[hpi]][2021-03-15] config: extending base config which has Paths/Pathish and List as the default attribute [[hpi]][2019-09-17] jlumpe/pyorg: Python library for working with Emacs org mode. [[org]][2020-10-05] seanbreckenridge/ipgeocache: A small cache layer for IP geolocation info [2020-05-21] ping/instagram_private_api: A Python library to access Instagram’s private API. [2020-10-15] wger/exercises.json at c70150b4850f2c7ab2fdc7a953c3c11f84d31e8c · wger-project/wger [[exercise]][2021-02-04] seanbreckenridge/discorddata: Library to parse messages/activity from the discord data export [[discord]] [[hpi]][2021-02-27] Upvoted submissions | Hacker News [[hackernews]] [[orger]] [[hpi]][2020-10-14] HPI/skype.py at 4a0eb2d8e3ae963e315f0eaa7f538b46ef5513f5 · seanbreckenridge/HPI [2021-04-05] piyueh/zoteroutils: Python API to interact with Zotero’s local SQLite database. [[zotero]] [[HPI]][2021-02-15] (6) InfluxData (@InfluxDB) / Twitter [[hpi]] [[publish]][2020-04-11] stephen-bunn/file-config: Attrs-like file config definitions inspired from https://github.com/hynek/environ_config [[configs]][2019-12-12] Re: [Scarygami/location-history-json-converter] Streaming parsing (#16) [[location]][2019-12-30] esnme/ultrajson: Ultra fast JSON decoder and encoder written in C with Python bindings [2020-05-15] Type alias as a class member is not valid as a type · Issue #7866 · python/mypy [[mypy]] [[hpi]][2020-05-12] HPI/CONFIGURING.org at master · karlicoss/HPI defensive Protocol stub? [2019-12-24] inspiration: credentials dashboard? Huginn [[hpi]][2021-04-04] Shell Completion — Click Documentation (7.x) [[hpi]]iter_tzs never exhausts? cause it doesn’t go over the last year. so it won’t cache things??](#hmmtrtrntrtzsnvrxhstscstdntgvrthlstyrstwntcchthngs TIDDLYLINK) [2020-12-07] CLI Guidelines – A guide to help you write better command-line programs | Hacker News [2020-11-14] Personal Data Warehouses: Reclaiming Your Data | Hacker News [2020-12-07] Leah Neukirchen (@LeahNeukirchen): "I put my IRC logs of the last decade into that, here is a dot for all 489398 lines I wrote:" | nitter [[viz]][2021-02-23] Yet another Тарантога [[hpi]][2020-10-05] mention data gathering libraries · seanbreckenridge/HPI@fbe4ffc [2020-10-19] Blog/ddde0c1c-8f73-47ff-803a-342f85a5fa72.md at 45f5922e999cc1ad8dba74f695d3762bed3624f6 · dentropy/Blog [2020-09-19] iterable -> iterator · seanbreckenridge/HPI@90a16bb [2020-01-01] John Stultz on Twitter: "random idea: Want something that I can point it at various services (imap/rss/other web services like gphotos,twitter) or takeout archives and it will import/dedup/index/archive locally on my system." / Twitter https://twitter.com/johnstultz_work/status/1156691692772196352 [[hpi]] [[webarchive]][2020-05-16] User awal | Lobsters [2020-05-02] hyfen.net/memex/updates/putting-the-memex-into-a-container-shazam-other-memex-sightings [2021-03-09] tried using monkeypatch to infer output types.. [[types]] [[hpi]][2021-03-07] Hypothesis [[hpi]][2021-03-08] Instagram/MonkeyType: A system for Python that generates static type annotations by collecting runtime types [[hpi]] [[cachew]][2021-04-12] Extract, transform, load - Wikipedia [[hpi]][2021-03-13] qsledger/instapaperdownloader.ipynb at master · markwk/qsledger [[hpi]][2020-01-17] Chatistics | Python scripts to parse your Messenger, Hangouts, WhatsApp and Telegram chat logs into DataFramespretty nice format; perhaps I should do that?
[2020-03-21] KrauseFx/FxLifeSheet: Tracking the key metrics of my life [[qs]]wow, that looks quite elaborate and cool!
[2019-12-11] Solid (web decentralization project) - Wikipedia [[solid]]Solid (Social Linked Data)[1] is a web decentralization project led by Tim Berners-Lee, the inventor of the World Wide Web, developed collaboratively at the Massachusetts Institute of Technology (MIT). The project "aims to radically change the way Web applications work today, resulting in true data ownership as well as improved privacy"[2] by developing a platform for linked-data applications that are completely decentralized and fully under users' control rather than controlled by other entities. The ultimate goal of Solid is to allow users to have full control of their own data, including access control and storage location. To that end, Tim Berners-Lee formed a company called Inrupt to help build a commercial ecosystem to fuel Solid.
[2019-12-18] ErikBjare/chatalysis: Analyse (group)chat messagesCurrently supports: Facebook Messenger. Planned: Slack, WhatsApp, Telegram, Signal, Wire
[2020-05-08] How this site works | Jack Reid [[hpi]][2020-05-18] Quarantine Notes - Week 10 | Ben CongdonThis probably warrants its own post, but I strongly agree with the philosophy of Dogsheep: everything lives in a SQLite database (that you own!), each exporter tool is its own separate CLI, and Datasette is an extremely flexible tool to explore data. The Dogsheep ecosystem is totally self-hosted (you own your data) and free (as in beer), unlike personal data aggregator platforms like Exist.io and Gyroscope.
[2021-02-28] Archivers [[hpi]][2021-03-19] LifeScope [[qs]] [[dashboard]] [[hpi]]https://github.com/LifeScopeLabs
[2020-05-14] could caption "HPI meets X" [[toblog]][2021-02-04] Apache Arrow 3.0 | Hacker News [[hpi]]Not only in between processes, but also in between languages in a single process. In this POC I spun up a Python interpreter in a Go process and pass the Arrow data buffer between processes in constant time. https://github.com/nickpoorman/go-py-arrow-bridge
hmm would be pretty cool if possible to use
[2020-03-18] ricklamers/gridstudio: Grid studio is a web-based application for data science with full integration of open source data science frameworks and languages [[pandas]]hmm, looks interesting, but it’s all dockerized, so might be tricky to expose my data..
[2020-05-09] Live demo · andrey-utkin/taskdb Wikiit is pretty neat already for analysis with querying and visualization. But your stuff is orders of magnitude bigger. Possibly I will set up HPI for myself some day.
[2020-09-11] [Kate on Twitter: "I made a super simple CLI plotting thingy, reads numbers on stdin, draws svg to stdout. Just for seeing the shape of data. It’s written in awk. https://t.co/TFYKbn2SKT" / Twitter](https://twitter.com/thingskatedid/status/1286559756967002113 ) [[tui]]made a super simple CLI plotting thingy, reads numbers on stdin, draws svg to stdout
[2021-02-08] Bram Wiepjes / baserow · GitLab [[hpi]] [[exobrain]]Open source online database tool and Airtable alternative.
That way would be able to easily import and remember lots of tgings. Just need stable IDs..
https://news.ycombinator.com/item?id=13597068
https://news.ycombinator.com/item?id=23860281
I evaluated on-premise Redash as an alternative for engineers and analysts who don't want to learn tableau. It's harder to setup than Metabase but more intuitive to use (for someone with SQL expertise).
[2020-10-31] Welcome to pyspread | pyspread [[hpi]] [[python]] [[spreadsheets]]pyspread expects Python expressions in its grid cells, which makes a spreadsheet specific language obsolete. Each cell returns a Python object that can be accessed from other cells. These objects can represent anything including lists or matrices.
[2020-01-10] Repl.it - Feed https://repl.it/talk/all?lang=python_turtle [[project]] [[promnesia]] [[demo]]Repl from Repo
Instantly run any GitHub repository.
[2020-10-16] Need your insights on a “Self Data Hub” ideation - Quantified Self / Apps & Tools - Quantified Self Forumhook it right into open humans
[2020-02-03] Foreign data wrappers - PostgreSQL wiki [[hpi]]Twitter
ok looks promising
tried https://www.visidata.org/docs/graph/ on bluemaestro
from my.bluemaestro import dataframe
df = dataframe()
import visidata
visidata.view_pandas(df.reset_index()[-1000:])
for all points, it was pretty slow… not sure why
[2019-12-20] Datasette — Datasette documentation tool for exploring data?https://datasette.readthedocs.io/en/stable
Datasette is a tool for exploring and publishing data. It helps people take data of any shape or size and publish that as an interactive, explorable website and accompanying API.
Datasette is aimed at data journalists, museum curators, archivists, local governments and anyone else who has data that they wish to share with the world.
e.g. https://github.com/markwk/qs_ledger/blob/master/instapaper/instapaper_data_analysis.ipynb
or lastfm ipynb?
[2021-01-01] List Of Virtual Tables [[sqlite]]A virtual table is an object that presents an SQL table interface but which is not stored in the database file, at least not directly. The virtual table mechanism is a feature of SQLite that allows SQLite to access and manipulate resources other than bits in the database file using the powerful SQL query language.
[2020-12-14] Simon Willison (@simonw): "sqlite-utils 3.1 adds a new command: sqlite-utils analyze-tables my.db It queries every column of every table and outputs useful statistics about them: https://sqlite-utils.readthedocs.io/en/stable/changelog.html#v3-1" | nitter [[hpi]]sqlite-utils 3.1 adds a new command:
sqlite-utils analyze-tables my.db
It queries every column of every table and outputs useful statistics about them
[2021-02-14] influxdata/influxdb-python: Python client for InfluxDB [[influx]] [[pandas]] [[hpi]]Additional dependencies are:
pandas: for writing from and reading to DataFrames (http://pandas.pydata.org/
hmm this is useful.. wonder if could benefit from it
[2020-06-16] A Jupyter Kernel for SQLite [[hpi]]https://blog.jupyter.org/a-jupyter-kernel-for-sqlite-9549c5dcf551
[2020-05-08] heedy/heedy: An Open-Source Platform for Quantified Self & IoT [[qs]][2021-02-11] Repl.it - Hosting Apps with Always On [[hpi]] [[promnesia]] [[computing]]As a reminder, Replit gives you most of what you need to rapidly build and ship apps in the cloud -- at lightning speed:
A blazing fast online IDE
Automatic Package Management
Automatic hosting
Automatic SSL/HTTPS
Domain linking
A simple and fast Database for persistence
A secure way to store secrets
[2020-10-15] wger-project/wger: Self hosted FLOSS fitness/workout and weight tracker written with Django [[exercise]]integrate with it?
e.g. depending on the ‘aspects’ the data provider has, would be different plots/dashboards
[2020-01-29] Typesense: Open-Source Alternative to Algolia [[hpi]] [[search]]https://github.com/typesense/typesense
[2021-03-05] Simon Willison (@simonw) / Twitter [[hpi]]finally need to cooperate with datasette…
e.g.
maybe it’s more of a platform to build your own layers etc
akin to spacemacs/doom
dump if install is editable or not
os/python version?
return previsits_to_history(*args, **kwargs, src='whatever')[0] # TODO meh
src/promnesia/common.py:333: in previsits_to_history
previsits = list(extr()) # TODO DEFENSIVE HERE!!!
src/promnesia/sources/takeout.py:105: in index
from my.google.takeout.paths import get_takeouts
from dataclasses import dataclass
from ...core.common import Paths
from my.config import google as user_config
@dataclass
> class google(user_config):
'''
Expects [[https://takeout.google.com][Google Takeout]] data.
E TypeError: no positional arguments expected
get_filescan handle all sorts of things
[2021-02-26] [karlicoss (ex. jestem króliczkiem) on Twitter: "@nikitavoloboev I guess if I decide on some opinionated defaults it could just be a single container/VM (maybe you’d need to specify the path to data on disk and that’s it). After that maybe people can decide whether they are happy with the defaults or are willing to tweak." / Twitter](https://twitter.com/karlicoss/status/1365431101917978624 ) [[hpi]] [[dashboard]] [[promnesia]][2020-11-10] User workflow documentation / understanding how components fit together · Issue 125 · karlicoss/promnesia[2020-05-18] HPI/SETUP.org at master · karlicoss/HPI~/.config/my/my/config.py
eh. not sure about this section…
can’t have config/repos dir and config.py at the same time
[2020-05-08] intake.github.io/status https://intake.github.io/status [[inspiration]]make_config isn’t even necessary if you’re not using default attributesalso default attributes are pretty important because of caching, error handling policies, etc
make_config as far as possible, and just use properties directly instead?? it’s only necessary for truly complicated hackeryhpi install [--user] my.modulename [[hpi]]my/core/init.py:40: UserWarning: 'my.config' package isn't found! (expected at /home/karlicos/.config/my). This is likely to result in issues.
See https://github.com/karlicoss/HPI/blob/master/doc/SETUP.org#setting-up-the-modules for more info.
""".strip())
✅ config file: my/config/__init__.py
❌ mypy check: failed
Can't find package 'my.config'
[2019-12-24] inspiration: hugginn credentials inspiration:http://localhost:3000/user_credentials
Your Credentials
Credentials are used to store values used by many Agents. Examples might include "twitter_consumer_secret", "user_full_name", or "user_birthday".
that’s quite nice; would be cool to display credentials for my kron thing?
better not to use it:
downsides:
that could help for configuration mistakes
Add an example, maybe with dynamic my.config module
[2020-05-16] Lazy — MacroPy3 1.1.0 documentation [[python]]hmmm… nice
maybe could try it dith defensive behaviour…
[2020-05-03] reddit: zstd vs lz4 comparison [[reddit]] [[exports]] [[hpi]]about 3803 files
du -ch *.xz | tail -n 1
2.1G total
du -ch *.zstd | tail -n1
2.9G total
[2020-05-03] comparison of zstd vs lz4 [[reddit]] [[hpi]](every tenth file, cache disabled)
lz4 : ./test 31.20s user 2.58s system 101% cpu 33.285 total
zstd: ./test 21.37s user 2.52s system 103% cpu 23.007 total
I mean, 1.5x is kinda nice…
[2021-03-15] config: extending base config which has Paths/Pathish and List as the default attribute [[hpi]]e.g. in mycfg
class commits:
roots: Sequence[PathIsh] = [L]
in my.commits
@dataclass
class commits_cfg(user_config):
roots: Sequence[PathIsh] # --- this complains ValueError: mutable default <class 'list'> for field roots is not allowed: use default_factory. shit
emails: Optional[Sequence[str]] = None
names: Optional[Sequence[str]] = None
huh, so adding roots equals field(default_factory=list) solved it?…
requires a bit of cooperation by using isinstance check in DAL? … maybe inputs should take str, dunno
wtf?????
has ‘playbackDate’ in episodes table
seems that only podcastAddict.db is useful, the rest is just crap
[2019-09-17] jlumpe/pyorg: Python library for working with Emacs org mode. [[org]]>>> org.orgdir # Obtained automatically from org-directory variable in Emacs
OrgDir('/home/jlumpe/org/')
huh that’s quite mad!
[2020-10-05] seanbreckenridge/ipgeocache: A small cache layer for IP geolocation info[2020-05-21] ping/instagram_private_api: A Python library to access Instagram’s private API.tests/takeout.py::test_location_perf
/home/karlicos/.local/lib/python3.7/site-packages/ijson/compat.py:47: DeprecationWarning:
ijson works by reading bytes, but a string reader has been given instead. This
probably, but not necessarily, means a file-like object has been opened in text
mode ('t') rather than binary mode ('b').
warnings.warn(_str_vs_bytes_warning, DeprecationWarning)
huh, that’s random
datetime.datetime(2012, 5, 8, 17, 37, 28, 181000, tzinfo=<DstTzInfo 'Europe/Moscow' MSK+4:00:00 STD>),
'Europe/Moscow'),
(datetime.datetime(2012, 5, 8, 20, 46, 27, 16000, tzinfo=<DstTzInfo 'Asia/Novosibirsk' +07+7:00:00 STD>),
'Asia/Novosibirsk'),
(datetime.datetime(2012, 5, 8, 20, 50, 3, 274000, tzinfo=<DstTzInfo 'Asia/Novosibirsk' +07+7:00:00 STD>),
'Asia/Novosibirsk'),
[2020-10-15] wger/exercises.json at c70150b4850f2c7ab2fdc7a953c3c11f84d31e8c · wger-project/wger [[exercise]]"creation_date": null,
"category": 12,
"uuid": "7ce6b090-5099-4cd0-83ae-1a02725c868b",
"muscles": [
12
],
"license": 1,
"name": "Pull-ups"
ok, nice it already has muscles involved.. I could use this data
https://github.com/twintproject/twint/issues/786
twint -u karlicoss --retweets
[2021-02-04] seanbreckenridge/discorddata: Library to parse messages/activity from the discord data export [[discord]] [[hpi]][2021-02-27] Upvoted submissions | Hacker News [[hackernews]] [[orger]] [[hpi]][2020-10-14] HPI/skype.py at 4a0eb2d8e3ae963e315f0eaa7f538b46ef5513f5 · seanbreckenridge/HPIugh. most libraries are outdated…
https://github.com/thampiman/reverse-geocoder
some hackery…
import geopy
from geopy.geocoders import Nominatim
from geopy.extra.rate_limiter import RateLimiter
locator = Nominatim(user_agent="myGeocoder")
# getloc = RateLimiter(locator.reverse, min_delay_seconds=0.001)
#
from functools import lru_cache
@lru_cache(None)
def query(p):
print("UNCACHED!! ", p)
return locator.reverse(p)
def getloc(p):
lat, lon = p
lat = round(lat, ndigits=3)
lon = round(lon, ndigits=3)
return query((lat, lon))
[2021-04-05] piyueh/zoteroutils: Python API to interact with Zotero’s local SQLite database. [[zotero]] [[HPI]]actually could even commit it to github…
use some really really public account?
faker can do that but doesn’t support schemas out of the box..
I appreciate not everyone uses the same data as I do.
My point is showing that my private layer is actually pretty thin and you can implement something TODO suiting you by looking at mine as an example.
Same way as TODO think of some analogy? when you’re using a todo list app, you’ve got your own unique pattern. Yet, we all benefit massively from sharing the same infrastructure
[2021-02-15] (6) InfluxData (@InfluxDB) / Twitter [[hpi]] [[publish]]could tweet at them/grafana?
have a screenshot
datasette .cache/my.photos.main:_photos --config max_returned_rows:20000
[2020-04-11] stephen-bunn/file-config: Attrs-like file config definitions inspired from https://github.com/hynek/environ_config [[configs]]https://github.com/stephen-bunn/file-config
maybe need some nicer algorithm, to prevent flickering (maybe it doesn’t happen anymore though)
[2019-12-12] Re: [Scarygami/location-history-json-converter] Streaming parsing (#16) [[location]]o Scarygami/location-history-json-converter, me, Author
Streaming parsing (--iterative) is now possible.
The functionality requires ijson to be installed.
[2019-12-30] esnme/ultrajson: Ultra fast JSON decoder and encoder written in C with Python bindingsmake it optional dependency with fallback?
[2020-05-15] Type alias as a class member is not valid as a type · Issue #7866 · python/mypy [[mypy]] [[hpi]]Alias = NamedTuple("Alias", [("field", str)])
hmm, alias could be used as ‘Like’ type? for makeconfig
[2020-05-12] HPI/CONFIGURING.org at master · karlicoss/HPI defensive Protocol stub?so using it requires guarding the code with if typing.TYPE_CHECKING, which is a bit confusing and bloating.
could have a defensive import in my.core.typing
[2019-12-24] inspiration: credentials dashboard? Huginn [[hpi]]Your Credentials
Credentials are used to store values used by many Agents. Examples might include "twitter_consumer_secret", "user_full_name", or "user_birthday".
from my.config import core as user_config # type: ignore[attr-defined]
maybe instead of defining dynamic bits, import stuff from my.module.config? and then override? not sure
[2021-04-04] Shell Completion — Click Documentation (7.x) [[hpi]]iter_tzs never exhausts? cause it doesn’t go over the last year. so it won’t cache things??and then, location caching also never properly happens. uhoh
for zone in pytz.all_timezones:
tz = pytz.timezone(zone)
infos = getattr(tz, '_tzinfos', [])
for _, _, x in infos:
tz_lookup[x] = tz
✅ config file : /.config/my/my/config/__init__.py
Compiling '/.config/my/my/config/__init__.py'...
*** OSError: [Errno 30] Read-only file system: '/.config/my/my/config/__pycache__'
✅ OK : my.reading.goodreads
✅ - stats: {'books': {'books': {'count': 222, 'last': datetime.datetime(2013, 7, 14, 2, 58, 4, tzinfo=datetime.timezone(datetime.timedelta(days=-1, seconds=61200)))}}, 'events': {'events': {'count': 222, 'last': datetime.datetime(2013, 7, 14, 2, 58, 4, tzinfo=datetime.timezone(datetime.timedelta(days=-1, seconds=61200)))}}, 'inputs': {'inputs': {'count': 934}}, 'reviews': {'reviews': {'count': 222}}}
❯ python3 xx.py
Traceback (most recent call last)
File "xx.py", line 6, in <module>
for x in M.bookmarks():
TypeError: <lambda>() missing 1 required positional argument: 'realf'
Uncategorized stuff
need to test behaviour w.r.t order of running local install?
[2020-12-07] CLI Guidelines – A guide to help you write better command-line programs | Hacker Newsif you are displaying tabular data, present an ncurses interface
feed into visidata?
[2020-11-14] Personal Data Warehouses: Reclaiming Your Data | Hacker NewsI believe all data warehouses are limited by the quality of their data model. Most start with good relational intentions over a small domain, but eventually get bogged down arguing how semantic angels might dance on ontological pins. The parts that work become ossified and impossible to change. The system starts to fragment into multiple federated datastores or unstructured file dumps (“big data!”) where you have to build your own integration every time you want to use the data. Someone comes along and proposes a unifying model (“everything is an event!”) and rebuilds the whole thing but with an extra layer of complexity. Someone suggests buying an industry data model instead - surely the data experts will have solved all these problems for us? A skunkworks project spins up and starts implementing the bought model with good relational intentions over a small domain...
I don’t think personal data warehouses are immune to any of these forces.
[2020-12-07] Leah Neukirchen (@LeahNeukirchen): "I put my IRC logs of the last decade into that, here is a dot for all 489398 lines I wrote:" | nitter [[viz]]<https://twitter.com/LeahNeukirchen/status/1335669406588923905 >
I put my IRC logs of the last decade into that, here is a dot for all 489398 lines I wrote:
[2021-02-23] Yet another Тарантога [[hpi]][2020-10-05] mention data gathering libraries · seanbreckenridge/HPI@fbe4ffcDisregarding tools which actively collect data (like [`ttt`](https://github.com/seanbreckenridge/ttt)/[`window_watcher`](https://github.com/seanbreckenridge/aw-watcher-window)), I have some other libraries I've created for this project, to provide more context to some of the data.
- [`ipgeocache`](https://github.com/seanbreckenridge/ipgeocache) - for any IPs gathered from data exports, provides geolocation info, so I have location info going back to 2013 (thanks facebook)
[2020-10-19] Blog/ddde0c1c-8f73-47ff-803a-342f85a5fa72.md at 45f5922e999cc1ad8dba74f695d3762bed3624f6 · dentropy/BlogWhat features would I want in my HPI?
[2020-09-19] iterable -> iterator · seanbreckenridge/HPI@90a16bbwonder why did he do that?
Iterable needs to be iter(), e.g. you can’t return list as Iterator
Good writeup. A couple points.
`zope.interface` is more explicit and scalable than `typing.Protocol`s, and more flexible than `abc.ABC`. There's a mypy plugin for it: https://github.com/Shoobx/mypy-zope
> The drawback is that code that changes the representation of its data a lot tends not to be fast code.
That's not a very convincing reason to avoid dataclasses except in the most performance-constrained environments -- and even then I'm doubtful it'd help. Especially with `slots=True`, dataclasses can take less resources.
[2020-01-01] John Stultz on Twitter: "random idea: Want something that I can point it at various services (imap/rss/other web services like gphotos,twitter) or takeout archives and it will import/dedup/index/archive locally on my system." / Twitter <https://twitter.com/johnstultz_work/status/1156691692772196352 > [[hpi]] [[webarchive]]John Stultz
@johnstultz_work
random idea: Want something that I can point it at various services (imap/rss/other web services like gphotos,twitter) or takeout archives and it will import/dedup/index/archive locally on my system.
[2020-05-16] User awal | LobstersAnyway, thanks a lot for building all this stuff. Definitely gonna explore and it also helped me refine some of my thoughts on the subject!
[2020-05-02] hyfen.net/memex/updates/putting-the-memex-into-a-container-shazam-other-memex-sightingsMy main objective right now is packaging what I’m working on into something that I can easily get to beta testers.
[2021-03-09] tried using monkeypatch to infer output types.. [[types]] [[hpi]]tried with my.pinboard module for bookmarks() function:
so all in all seems that it would be easier to assume Res[X] and try to guess X?
Url = NewType('Url', str)
what’s up with this Bookmark thing??
[ins] In [24]: inspect.signature(Bookmark.url.fget)
Out[24]: <Signature (self) -> <function NewType.<locals>.new_type at 0x7f9c8626ce50>>
[2021-03-07] Hypothesis [[hpi]]update hypothesis link?
[2021-03-08] Instagram/MonkeyType: A system for Python that generates static type annotations by collecting runtime types [[hpi]] [[cachew]]MonkeyType collects runtime types of function arguments and return values, and can automatically generate stub files or even add draft type annotations directly to your Python code based on the types collected at runtime.
could use for some magic caching/inference of serialization? not sure
[2021-04-12] Extract, transform, load - Wikipedia [[hpi]]I guess it’s kind of ‘auto’? Although ETL sounds a bit magical
[2021-03-13] qsledger/instapaperdownloader.ipynb at master · markwk/qsledger [[hpi]]see what’s their approach to credentials
Expanding this section will automatically generate an AI synthesis of the contributions in this node.